Protein coding transcript 14019

• Transcript: Ll_transcript_324010
• CDS coordinates: 90-803 (+)
• Peptide sequence: MEIEQENGNIHHDYNHHQENENERVNGCLSSFIDDGSIESHRYYLSRRTALEMLKDRGYSVPSSEIEISLSEFRAIHGHNPDVERLRFSATHQSNPSKRILVIFCGPGVVKVNVIRNIAGQIVNRETLTGLILVVQNQITAQALKAVKIFSFKVEIFQITDLLVNITKHVLKPKHEVLTEQQKQSLLKKYSLEEKQLPRMLQTDAITKYYGLERGQVVKVTYNGEVTQLHVTYRCVW*
• ORF Type: complete

Annotations of Ll_transcript_324010

• Blastp: DNA-directed RNA polymerase V subunit 5A from Arabidopsis with 60.48% of identity
• Blastx: DNA-directed RNA polymerase V subunit 5A from Arabidopsis with 59.9% of identity
• Eggnog: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates(COG2012)
• Kegg: Link to kegg annotations (AT3G57080)
• CantataDB: Link to cantataDB annotations (CNT0001929)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437055.1)
• Pfam: RNA polymerase Rpb5, N-terminal domain (PF03871.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;