Protein coding transcript 140214

• Transcript: Ll_transcript_194765
• CDS coordinates: 418-1080 (+)
• Peptide sequence: MQSLFTSIIANLVLLILLPFSHAGLLSQPVQPLEPGNYPSPNTVPAFPVQTQTQTCRLDLSNELFGGVNAACGKNLDRNRCCPVLAAWLFAAHARTALELSPSPSPAPSASSGVGELPMMPDDSQKCVNSLQDSLLSRNIRIPQPNASCDAILCFCGIRLHQISSLSCPAAFNVSGSFKNATPTAAVRNLEKNCRNSSYAGCSNCLGALQKVQPLIIIIK*
• ORF Type: complete

Annotations of Ll_transcript_194765

• Blastp: Uncharacterized GPI-anchored protein At4g28100 from Arabidopsis with 73.3% of identity
• Blastx: Uncharacterized GPI-anchored protein At4g28100 from Arabidopsis with 71.2% of identity
• Eggnog: NA(ENOG410YB0S)
• Kegg: Link to kegg annotations (AT4G28100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448970.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;