Protein coding transcript 140241

• Transcript: Ll_transcript_194254
• CDS coordinates: 28-531 (+)
• Peptide sequence: MHHCKTTYFQVAISFMKIIMLSIGPGIETLGKLPGTNMFCDVHQYPMAIKIPGVAIVRIKSSMLCFSNANSITERVTKWITEEEAEGKRSIIQLVIIDASNLVSIDTSGIASLEKLHKNLVSSGKQLAIANPRWKVIYKLKTTNFVKRIGGRVFLTVGEAVESKLDF*
• ORF Type: complete

Annotations of Ll_transcript_194254

• Blastp: Low affinity sulfate transporter 3 from Stylosanthes with 51.25% of identity
• Blastx: Low affinity sulfate transporter 3 from Stylosanthes with 51.25% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462454.1)
• Pfam: STAS domain (PF01740.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;