Protein coding transcript 140242

• Transcript: Ll_transcript_194255
• CDS coordinates: 127-837 (+)
• Peptide sequence: MSNIVMAVTVIISLLCLTKLLYFTPTAILASIILSALPGLIDINEGYKIWKTDKVDFLACIGAFFGVMFVSVEIGLLVAVAISFMKIIMLSIGPGIETLGKLPGTNMFCDVHQYPMAIKIPGVAIVRIKSSMLCFSNANSITERVTKWITEEEAEGKRSIIQLVIIDASNLVSIDTSGIASLEKLHKNLVSSGKQLAIANPRWKVIYKLKTTNFVKRIGGRVFLTVGEAVESKLDF*
• ORF Type: complete

Annotations of Ll_transcript_194255

• Blastp: Low affinity sulfate transporter 3 from Stylosanthes with 59.41% of identity
• Blastx: Sulfate transporter 2.1 from Arabidopsis with 61.96% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462454.1)
• Pfam: Sulfate permease family (PF00916.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;