Protein coding transcript 140258

• Transcript: Ll_transcript_194543
• CDS coordinates: 2598-2903 (+)
• Peptide sequence: MAPESVHGTREGQRKRGRNPADKESKRLKRLLRNRVSAQQARERKKAYLNDLETKVKDLEKKNSELKERLSTLQNENQMLRQILKNTTATRRGSNSGANAE*
• ORF Type: complete

Annotations of Ll_transcript_194543

• Blastp: Transcription factor HY5 from Arabidopsis with 79.12% of identity
• Blastx: Transcription factor HY5 from Arabidopsis with 69.17% of identity
• Eggnog: Transcription factor(ENOG4111CH5)
• Kegg: Link to kegg annotations (AT5G11260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437116.1)
• Pfam: bZIP transcription factor (PF00170.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;