Transcript | Ll_transcript_194544 |
---|---|
CDS coordinates | 2806-3111 (+) |
Peptide sequence | MAPESVHGTREGQRKRGRNPADKESKRLKRLLRNRVSAQQARERKKAYLNDLETKVKDLEKKNSELKERLSTLQNENQMLRQILKNTTATRRGSNSGANAE* |
ORF Type | complete |
Blastp | Transcription factor HY5 from Arabidopsis with 79.12% of identity |
---|---|
Blastx | Transcription factor HY5 from Arabidopsis with 69.17% of identity |
Eggnog | Transcription factor(ENOG4111CH5) |
Kegg | Link to kegg annotations (AT5G11260) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437116.1) |
Pfam | bZIP transcription factor (PF00170.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer