Protein coding transcript 140262

• Transcript: Ll_transcript_194547
• CDS coordinates: 193-663 (+)
• Peptide sequence: MKQSGGMGNGSQERNQLVRASHGSDNGSNKPLKNLNGQVCEVCGDTVGFTTTGDVFVDCQECGFPLCHNCYEYELKNGNQSCPKCKTRYKSHKVIPQLGGDDQDDDVDNPENEASYGQGNTKTGLQWEEEADLSSSSGHDSQQPKSHLTNGQLVMY*
• ORF Type: complete

Annotations of Ll_transcript_194547

• Blastp: Probable cellulose synthase A catalytic subunit 10 [UDP-forming] from Arabidopsis with 52.03% of identity
• Blastx: Transcription factor HY5 from Arabidopsis with 69.17% of identity
• Eggnog: Glycosyl transferase, family 2(COG1215)
• Kegg: Link to kegg annotations (AT2G25540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437116.1)
• Pfam: Zinc-binding RING-finger (PF14569.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;