Transcript | Ll_transcript_194596 |
---|---|
CDS coordinates | 240-830 (+) |
Peptide sequence | MSANPLQALFHNFDQVSKFVQYHLSNFIGFHLQPSGPSARGPIFSISSSSKALPLAKITPVNPGDNALKGKSATPAAKEELGRATWTFLHTLAAQYPDNPTRQQKKDVKELIQILTRMYPCKDCADHFKEVIRANPVQAGSHAEFSQWLCHVHNVVNRSLGKAVFPCERVDARWGKLECEQRQCEIIGSTSIFGKI* |
ORF Type | complete |
Blastp | FAD-linked sulfhydryl oxidase ERV1 from Arabidopsis with 61.03% of identity |
---|---|
Blastx | FAD-linked sulfhydryl oxidase ERV1 from Arabidopsis with 60.3% of identity |
Eggnog | thiol oxidase activity(COG5054) |
Kegg | Link to kegg annotations (AT1G49880) |
CantataDB | Link to cantataDB annotations (CNT0000758) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447568.1) |
Pfam | Erv1 / Alr family (PF04777.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer