Protein coding transcript 140564

• Transcript: Ll_transcript_194460
• CDS coordinates: 115-504 (+)
• Peptide sequence: MERPCFSHLLAFLNFFLNQQEREHYEYIVCEGKIIHKYSGDVLHTKEGSEDAKWIFVMSTSKKLYAGKVTIQAKFLFLVSSFVIYVHDLRYFFSALLIHCNNLPEKEGIIPSFFLFSWRSYLSCWKAGG*
• ORF Type: complete

Annotations of Ll_transcript_194460

• Blastp: IQ domain-containing protein IQM3 from Arabidopsis with 58.82% of identity
• Blastx: IQ domain-containing protein IQM3 from Arabidopsis with 60.94% of identity
• Eggnog: NA(ENOG410XYBD)
• Kegg: Link to kegg annotations (AT3G52870)
• CantataDB: Link to cantataDB annotations (CNT0001147)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417633.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;