Transcript | Ll_transcript_194460 |
---|---|
CDS coordinates | 115-504 (+) |
Peptide sequence | MERPCFSHLLAFLNFFLNQQEREHYEYIVCEGKIIHKYSGDVLHTKEGSEDAKWIFVMSTSKKLYAGKVTIQAKFLFLVSSFVIYVHDLRYFFSALLIHCNNLPEKEGIIPSFFLFSWRSYLSCWKAGG* |
ORF Type | complete |
Blastp | IQ domain-containing protein IQM3 from Arabidopsis with 58.82% of identity |
---|---|
Blastx | IQ domain-containing protein IQM3 from Arabidopsis with 60.94% of identity |
Eggnog | NA(ENOG410XYBD) |
Kegg | Link to kegg annotations (AT3G52870) |
CantataDB | Link to cantataDB annotations (CNT0001147) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417633.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer