Protein coding transcript 140572

• Transcript: Ll_transcript_108450
• CDS coordinates: 110-1012 (+)
• Peptide sequence: MGFVKVVKNKQYFKRYQVKFKRRREGKTDYYARKRLIVQDKNKYDTPKYRLIVRFSNRDITCQVAHSRIEGDKIVCAAYSHELPKYGIKVGLTNYAAAYCTGLLVARRLLKKLGLDRLYEGLKEANGEEYYVEPADEGPNAFRCNLDVGLMKTSTGARVFGAMKGAVDGGFNIPHSVKRFPGYDAEAKEYSAETHRKHILGLHVAEYMRKLEEEDEDSYNRQFSQYIKLGIVADDLENMYKKAHENIRSDPKRDRKPKKEVSKEPKRWNAKKLTNAERKQRVVDAKAAYLKELQGEEMES*
• ORF Type: complete

Annotations of Ll_transcript_108450

• Blastp: 60S ribosomal protein L5 from Toxoptera with 98.33% of identity
• Blastx: 60S ribosomal protein L5 from Toxoptera with 98.33% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017408388.1)
• Pfam: Ribosomal large subunit proteins 60S L5, and 50S L18 (PF17144.3)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;