Protein coding transcript 140613

• Transcript: Ll_transcript_108621
• CDS coordinates: 1-384 (+)
• Peptide sequence: LIYSHLFVLLLCKPIPFIEPGILPSLSSDLDHHHNIHIKTQKKEQNMALLLNKTLASHFRSHAKKTEDSIYLPRRGFHVEPGTREKAVRLKTSLFVNFFNDLNNLVLLYHLFQVIVSFIYTYNSGKK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_108621

• Blastp: Succinate dehydrogenase subunit 7B, mitochondrial from Arabidopsis with 44.44% of identity
• Blastx: Succinate dehydrogenase subunit 7B, mitochondrial from Arabidopsis with 78% of identity
• Eggnog: NA(ENOG410Y7N2)
• Kegg: Link to kegg annotations (AT5G62575)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435160.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;