Protein coding transcript 140745

• Transcript: Ll_transcript_108759
• CDS coordinates: 3-869 (+)
• Peptide sequence: STFSFFKAATRWSKNHKFFLTSFGVLAGGGSSLIYALEQSIHASNDAAHVAKQKWNHNGWFDTLDHASVRRGWEVYKNVCAACHSIEYLAYRELVGVCLTEDEAKAEAAEQMIDDGPDETGAMYKRPGKLSDLLPKPYPNEEAARYSNGGAYPPDLTYITQARIDGENYIFALLTGYMDPPAGISLAENQHYNPYFPGGAIGMAQALYDEIIEYGDGTPATQSQCAKDVITFLKWCAEPEHDTRKLFAMKAFTILGVLNLVVWYLHRHYWSVLKSRKILQSPKSLFKK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_108759

• Blastp: Cytochrome c1, heme protein, mitochondrial from Bos with 56.3% of identity
• Blastx: Cytochrome c1, heme protein, mitochondrial from Bos with 56.3% of identity
• Eggnog: cytochrome c1(COG2857)
• Kegg: Link to kegg annotations (512500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014505469.1)
• Pfam: Cytochrome C1 family (PF02167.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;