Protein coding transcript 140861

• Transcript: Ll_transcript_108730
• CDS coordinates: 2-568 (+)
• Peptide sequence: WRVISSIEQKTEGSERKQQMAKEYREKVEKELREICYDVLQGLLDKYLIPKASNAESKVFYLKMKGDYYRYLAEVAQGENRNTVVDDSQKAYQDAFEISKAKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDADEPQEGGDN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_108730

• Blastp: 14-3-3 protein zeta from Bombyx with 94.15% of identity
• Blastx: 14-3-3 protein zeta from Bombyx with 94.15% of identity
• Eggnog: Tyrosine 3-monooxygenase tryptophan 5-monooxygenase activation protein(COG5040)
• Kegg: Link to kegg annotations (692854)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016182680.1)
• Pfam: 14-3-3 protein (PF00244.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;