Protein coding transcript 140870

• Transcript: Ll_transcript_108664
• CDS coordinates: 83-772 (+)
• Peptide sequence: MTNAFTLLLLLLLVLFISNGSEAQNKTQPGRPKAPVGKAKAKAKAKAIPDPDALPPAAENCNGVYISYDFHSRKKEFPRVKNASAQSWAFNATAVVLNTGKDILKQWKLFIEFQHDEILVNVNGGVLFDGEDFPASVGNGTRIVGGSNADLDTSINTANDLTQIQAEILISGTQFGVRTNGIPMPKTIKLENDGYKCPPPTTKSHSPRPSLFYHHHFIFYNVHYLINIFI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_108664

• Blastp: COBRA-like protein 10 from Arabidopsis with 43.35% of identity
• Blastx: COBRA-like protein 10 from Arabidopsis with 52.05% of identity
• Eggnog: cobra-like protein(ENOG410ZHV6)
• Kegg: Link to kegg annotations (AT3G20580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444530.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;