Protein coding transcript 140905

• Transcript: Ll_transcript_108499
• CDS coordinates: 196-984 (-)
• Peptide sequence: MLSIIQLDSTQRITLALKLSSMLFLFSSALSANSYPTRANIFIYAGCSQEKYQPSSPFEANLNSFLSSVVSSSSQVIYNSFAVGNDSSESSEGAVFGLYQCRGDLRPIDCSKCVGRLVNQIGLVCPYTTGASLQLDGCYLRYEHYGDFLGKLDTGLRYRKCSKAMASDADFFRRRDDVLADLQSANGFRVSSSGLVQGYAQCLGDLTVSDCSSCISDAVGKLKSLCGSAASADVFLGQCYARYWASGYYDESGSFHSHSSLS*
• ORF Type: complete

Annotations of Ll_transcript_108499

• Blastp: Cysteine-rich repeat secretory protein 15 from Arabidopsis with 66.2% of identity
• Blastx: Cysteine-rich repeat secretory protein 15 from Arabidopsis with 66.2% of identity
• Eggnog: cysteine-rich repeat secretory protein(ENOG410YAWB)
• Kegg: Link to kegg annotations (AT3G60720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465128.1)
• Pfam: Salt stress response/antifungal (PF01657.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;