Transcript | Ll_transcript_324136 |
---|---|
CDS coordinates | 556-1119 (+) |
Peptide sequence | MELGSCVKENSFNDHYSVYAGEALDELPDSFTITDPSIPGHPIIFASLGFLNMTGYTREEVVGNSGAMFQGSGTCRRAVMEIREAIREERKTQVVLLNYRKDGTPFWMLFHMSPVFTEHYGGVVHFVAVQVPLQKKMNFYEDGSRLQQDFVFGYCRKEVCLDSVLGLGRVCPMDQHDDVRGLCVFSS* |
ORF Type | complete |
Blastp | Protein TWIN LOV 1 from Arabidopsis with 55.87% of identity |
---|---|
Blastx | Protein TWIN LOV 1 from Arabidopsis with 55.87% of identity |
Eggnog | Histidine kinase(COG2202) |
Kegg | Link to kegg annotations (AT2G02710) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434580.1) |
Pfam | PAS domain (PF13426.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer