Protein coding transcript 140914

• Transcript: Ll_transcript_108556
• CDS coordinates: 358-945 (+)
• Peptide sequence: METTHLLILVLGPTLATFFVILAVFLCRVRKSKHGSGRDIEWSEQNNQEDDIIQKEDLIIFEGGEDLTICDMLDAPGEVIGKSNYGTLYKALLQRSNKVRLLRFLRPVCTTRAEDLDEIVQVIGRIRHPNLVPLFGFYTGPRFEKLLVHPFYRHGNLAQFIRGDNDSLTCLSLKSVFSLCSHFVKFNLMLCPDFY*
• ORF Type: complete

Annotations of Ll_transcript_108556

• Blastp: Probable leucine-rich repeat receptor-like protein kinase IMK3 from Arabidopsis with 32.16% of identity
• Blastx: Putative kinase-like protein TMKL1 from Arabidopsis with 36.02% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G56100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464987.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;