Transcript | Ll_transcript_108654 |
---|---|
CDS coordinates | 1608-2087 (+) |
Peptide sequence | MGLMKYGKGDWRNISRNFVVTKTPTQVASHAQKYYIRQKDSGVKDKRRPSIHDITTVNLTETVTSDKNNPLLFNESLMLEPQQKLSTSMSKVQLEWINHNNDGSLMVFNPNCDDLLKVQEQDLNDCAFHEAYAKLQIPSFTTASRDFNKEAVFGIHALS* |
ORF Type | complete |
Blastp | Transcription factor DIVARICATA from Antirrhinum with 46.54% of identity |
---|---|
Blastx | Transcription factor DIVARICATA from Antirrhinum with 51.43% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454444.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer