Protein coding transcript 14098

• Transcript: Ll_transcript_324124
• CDS coordinates: 556-1119 (+)
• Peptide sequence: MELGSCVKENSFNDHYSVYAGEALDELPDSFTITDPSIPGHPIIFASLGFLNMTGYTREEVVGNSGAMFQGSGTCRRAVMEIREAIREERKTQVVLLNYRKDGTPFWMLFHMSPVFTEHYGGVVHFVAVQVPLQKKMNFYEDGSRLQQDFVFGYCRKEVCLDSVLGLGRVCPMDQHDDVRGLCVFSS*
• ORF Type: complete

Annotations of Ll_transcript_324124

• Blastp: Protein TWIN LOV 1 from Arabidopsis with 55.87% of identity
• Blastx: Protein TWIN LOV 1 from Arabidopsis with 55.87% of identity
• Eggnog: Histidine kinase(COG2202)
• Kegg: Link to kegg annotations (AT2G02710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434580.1)
• Pfam: PAS domain (PF13426.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;