| Transcript | Ll_transcript_108931 |
|---|---|
| CDS coordinates | 1-354 (+) |
| Peptide sequence | SLTLIFLTSIPSTIHIFFCFFHSSLLSFKRFCEYSCKNCFKVMERLNSELYIQNCYIMKENERLRKKAQLLNQENQELLSELKQKLSKTNQKPNAPNNILDLNLGSSSNQNASSSNN* |
| ORF Type | 5prime_partial |
| Blastp | Protein LITTLE ZIPPER 4 from Arabidopsis with 87.23% of identity |
|---|---|
| Blastx | Protein LITTLE ZIPPER 4 from Arabidopsis with 88.46% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | Link to cantataDB annotations (CNT0002523) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019431501.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer