| Transcript | Ll_transcript_261039 |
|---|---|
| CDS coordinates | 2-307 (+) |
| Peptide sequence | ILRVLSTSLKALKSCCSKYTHIPSNRINQTQFGALNQSNTLQPSHWNMATQNSQIYHENQSLQFCLLHTLNSLFQPHHNVLTGNYDVNVLIAALEDRGKSVI |
| ORF Type | internal |
| Blastp | Josephin-like protein from Arabidopsis with 44.44% of identity |
|---|---|
| Blastx | Josephin-like protein from Arabidopsis with 44.44% of identity |
| Eggnog | Josephin domain containing(ENOG4111I4J) |
| Kegg | Link to kegg annotations (AT2G29640) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020209411.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer