Transcript | Ll_transcript_261027 |
---|---|
CDS coordinates | 468-809 (+) |
Peptide sequence | MDSQGQTTSLQRLQNVEKRIVKVLELAGGVMDELASPVGPRKELVQNHCLEFMQLIKDIQVALRDEIKSACEYRPFEKCDYGPRITNEICYNKVEYVISQLDAIKQTIHHYHA* |
ORF Type | complete |
Blastp | Mediator of RNA polymerase II transcription subunit 11 from Arabidopsis with 71.68% of identity |
---|---|
Blastx | Mediator of RNA polymerase II transcription subunit 11 from Arabidopsis with 72.97% of identity |
Eggnog | mediator of RNA polymerase II transcription, subunit 11(ENOG4111TND) |
Kegg | Link to kegg annotations (AT3G01435) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418609.1) |
Pfam | Mediator complex protein (PF10280.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer