Transcript | Ll_transcript_261178 |
---|---|
CDS coordinates | 150-722 (+) |
Peptide sequence | MPSLCIFTPFPSLQNPNFHHTHFFNSPITSHLHFSLTKIHFHRKIHCNALKDSSEEIKAVLGSDGGGGGDGGDGGNDGDGDRSKKVEKKDGSLPDWLNFTSDDAKTVFAALAISLAFRTFVAEPRYIPSLSMYPTFDVGDRLVAEKVLFLLLKLVTFFLVFVVNVNLSHEKILEWKMEVMWVLERKKMGK* |
ORF Type | complete |
Blastp | Chloroplast processing peptidase from Arabidopsis with 49.32% of identity |
---|---|
Blastx | Chloroplast processing peptidase from Arabidopsis with 46.12% of identity |
Eggnog | Signal peptidase i(COG0681) |
Kegg | Link to kegg annotations (AT3G24590) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422133.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer