Transcript | Ll_transcript_261318 |
---|---|
CDS coordinates | 1316-2767 (+) |
Peptide sequence | MGPSFSTTTLFFSIYISSKLPLWLFTQSSLKSLTIGYSSFSFESHDKFWNFAQLEFLSLGYNVIDGDLSNVLINSKVSWLSHNIWRSGFPRISANVTLLNLHDNSLSGSLSSLLCNKMKAKSKLEFLDVSHNNLSGGLTDCWMHWKSLLHVNLGHNNLTGEIPQSMGLLSNLFSLHLNNNKLFGKVPMSLKNCQKLWILDLGGNKFSGVIPYWTGHSIKALQLRSNEFSGNIPSQICHFSSVQVMDFANNTLSGAIPDCLHNITSMVSNHATFDLFFIKIYIIDRMMTFGINVVLPIKGNELAYHQDLFYLIDLSSNNLSGTIPLEIYKLNRLQSLNLSHNQLLGMIPQEIDNLHQLESIDLSSNLLFGEIPQSISGLSFLGNLNLSYNNFMGRIPSGIQLQSFTNLSYIGNPNLCGPPLTKKCTQVDKSDNIKPKGEDNDDEEDESEVHWWSWFYMGMGIGFGTGFWVVVGSIFFNRTCRHA* |
ORF Type | complete |
Blastp | Receptor-like protein 12 from Arabidopsis with 29.98% of identity |
---|---|
Blastx | Probable LRR receptor-like serine/threonine-protein kinase At4g36180 from Arabidopsis with 30.07% of identity |
Eggnog | leucine Rich Repeat(COG4886) |
Kegg | Link to kegg annotations (AT1G71400) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_006589512.2) |
Pfam | Leucine Rich repeat (PF13516.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer