Protein coding transcript 141284

• Transcript: Ll_transcript_261254
• CDS coordinates: 1-363 (-)
• Peptide sequence: QDRGVSVKDYLVDKLRPSEEDKVLSEVITESLHNKKEEPTEVRDVKNVISNAVHKREEEPGIREKYRPLGKVTESEEVKMRLGTDEKAERRYEDIYVNSPGTGVVDKLKNVVGSWFGGNPE
• ORF Type: internal

Annotations of Ll_transcript_261254

• Blastp: Low-temperature-induced 65 kDa protein from Arabidopsis with 31.75% of identity
• Blastx: Low-temperature-induced 65 kDa protein from Arabidopsis with 31.75% of identity
• Eggnog: low-temperature-induced 65(ENOG410ZG4Y)
• Kegg: Link to kegg annotations (AT5G52300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453880.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;