Protein coding transcript 141294

• Transcript: Ll_transcript_261267
• CDS coordinates: 32-670 (+)
• Peptide sequence: MMYSSCSSSSSMTLSMTMIRRRFCSLHNYSVTSSSSITNTKKKSVVVLGAPKVSAIVLEALLKAQSQSNSLFEVSGIVTQPPSKRDRGKVLMPTPLAQFAIQNGFDSDLIFTPQRAGDDDFLSQFKALQPDLCVTAAYGNILPNKFLQLPPLGTVNIHPSLLPMYRGAAPVQRALQDGVKETGVSLAFTVRALDAGPVIATESVQVDDQIKV*
• ORF Type: complete

Annotations of Ll_transcript_261267

• Blastp: Methionyl-tRNA formyltransferase from Dictyoglomus with 39.64% of identity
• Blastx: Methionyl-tRNA formyltransferase from Dictyoglomus with 39.76% of identity
• Eggnog: Modifies the free amino group of the aminoacyl moiety of methionyl-tRNA(fMet). The formyl group appears to play a dual role in the initiator identity of N-formylmethionyl-tRNA by (I) promoting its recognition by IF2 and (II) impairing its binding to EFTu-GTP (By similarity)(COG0223)
• Kegg: Link to kegg annotations (DICTH_1334)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449712.1)
• Pfam: Formyl transferase (PF00551.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;