Protein coding transcript 141319

• Transcript: Ll_transcript_261018
• CDS coordinates: 77-814 (+)
• Peptide sequence: MAATPFLILQPRFNSYINPLFRSLSSSPLSFNAATAIQSSLSPPSDTHSSTAAGRSGALSPAPPLSGAVQKIDVNPPKGTRDFPPEDMRLRNWLFNNFREVSRLYAFEEVDFPVLENEALFTRKAGEEIKDQLYCFEDQGKRRVALRPELTPSLARLVIQKGKSVSLPLKWFTVGQCWRYERMTRGRRREHYQWNMDIIGVPGVMAEAELIASIVTLFKRIGITESDVGFKVSSRKVQTLFSSYE*
• ORF Type: complete

Annotations of Ll_transcript_261018

• Blastp: Histidine--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 75.46% of identity
• Blastx: Histidine--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 81.03% of identity
• Eggnog: Histidyl-trna synthetase(COG0124)
• Kegg: Link to kegg annotations (AT3G46100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456673.1)
• Pfam: Histidyl-tRNA synthetase (PF13393.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;