Protein coding transcript 141346

• Transcript: Ll_transcript_261455
• CDS coordinates: 437-1030 (+)
• Peptide sequence: MIVQFLDENGQRQHVWQTSWAISTRFIGGIIMTHGDDAGLMLPPKVAPVQVVIVPIWKKDDEKTAVLKATSSVKETLQAAGIRVKLDDSDQRTPGWKFNFWEMKGVPLRIEIGPRDVSSGSVVISRRDVPGKQGKVFGVSMDPPILEAFVKDNLDAIQSSLLERAIAFRDSNIVDVSSYDDLKAAISQGKWARGPWSA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_261455

• Blastp: Proline--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 80.61% of identity
• Blastx: Proline--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 79.1% of identity
• Eggnog: Catalyzes the attachment of proline to tRNA(Pro) in a two-step reaction proline is first activated by ATP to form Pro- AMP and then transferred to the acceptor end of tRNA(Pro). As ProRS can inadvertently accommodate and process non-cognate amino acids such as alanine and cysteine, to avoid such errors it has two additional distinct editing activities against alanine. One activity is designated as 'pretransfer' editing and involves the tRNA(Pro)-independent hydrolysis of activated Ala-AMP. The other activity is designated 'posttransfer' editing and involves deacylation of mischarged Ala-tRNA(Pro). The misacylated Cys- tRNA(Pro) is not edited by ProRS (By similarity)(COG0442)
• Kegg: Link to kegg annotations (AT5G52520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428366.1)
• Pfam: Anticodon binding domain (PF03129.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;