Protein coding transcript 141440

• Transcript: Ll_transcript_117164
• CDS coordinates: 573-1256 (+)
• Peptide sequence: MLNDRKSRFSLNGKPLYHFMGTSTFSQYTVVHDVSVAKIDPKAPLEKVCLLGCGVPTGLGAVWNTAKVEAGSNVAIFGLGTVGLAVAEGAKAAGASRIIGIDIDSKKFEVAKNFGVTEFINPKEHEKPIQQVIVDETDGGVDYSFECIGNVSVMRSALECCHKGWGTSVIVGVAGSGQEISTRPFQLVTGRVWKGTAFGGFKSRSQVPWLVEKYLKKVKFFFMNFLI*
• ORF Type: complete

Annotations of Ll_transcript_117164

• Blastp: Alcohol dehydrogenase class-3 from Oryza sativa with 92.63% of identity
• Blastx: Alcohol dehydrogenase class-3 from Oryza sativa with 92.75% of identity
• Eggnog: alcohol dehydrogenase(COG1062)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425929.1)
• Pfam: Zinc-binding dehydrogenase (PF00107.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;