Transcript | Ll_transcript_117045 |
---|---|
CDS coordinates | 141-797 (+) |
Peptide sequence | MPGLTIGDTIPNLEVESTNGKINLHHFCIDSWTILFSHPGDFTPVCTTELGQMAKYSSEFYQRGVKLLGLSCDDLKTHNEWIKDIEAYTPGAKVNFPIISDPKREIIKQLNMVDPDEKDSIGNLPSRALHIVGPDKKIKLSFLYPATTGRNVDEVLRVVESLQKASKFKVATPANWKPGEKVVISPDVTNEQAKEMFPQGFETKDLPSKKEYLRFVKV* |
ORF Type | complete |
Blastp | 1-Cys peroxiredoxin from Medicago with 86.7% of identity |
---|---|
Blastx | 1-Cys peroxiredoxin from Medicago with 86.7% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463244.1) |
Pfam | AhpC/TSA family (PF00578.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer