Transcript | Ll_transcript_116730 |
---|---|
CDS coordinates | 630-1472 (+) |
Peptide sequence | MSSSNSPCAACKFLRRKCTQECPFAPYFPPDNPQRFSCVHRVFGASNVAKLLNELNPSQREDAVKSLAYEAEARLRDPVYGCIGYISVLQHKLRQIQSNIHSAKKELSTYLNPQAMQALQAMLENPNMIQPNGLVMPQQHQVGNPFQANIGFSPYGNTNVMVGQHNQLPIGDQRQDLLDVQQLGVEQEYLRLNGLEGMGGNGGDNGFNQMGVGPELALATFDNVGPYEIQQQQGEHHHHHHQHHVEEPLLLLPQQTQPQEHQLSLQQPQGGDRRSVGPSG* |
ORF Type | complete |
Blastp | LOB domain-containing protein 36 from Arabidopsis with 65.96% of identity |
---|---|
Blastx | LOB domain-containing protein 36 from Arabidopsis with 65.96% of identity |
Eggnog | lob domain-containing protein(ENOG410YGE6) |
Kegg | Link to kegg annotations (AT5G66870) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433268.1) |
Pfam | Lateral organ boundaries (LOB) domain (PF03195.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer