Protein coding transcript 141772

• Transcript: Ll_transcript_117064
• CDS coordinates: 302-736 (+)
• Peptide sequence: MSLQLLSQVPDYAMSFVNGTSSKPFARLWWDETVPTVVTRAEPHNQAIMHPEQDRVLTIRENARLQGFPDYYKLCGPVKARYIQVGNAVAVPVARALGYTLGLSFQGPVAAAAAAVADGPLYKLPEKFPILTERVSSVSSEDIA*
• ORF Type: complete

Annotations of Ll_transcript_117064

• Blastp: DNA (cytosine-5)-methyltransferase CMT1 from Oryza sativa with 72.5% of identity
• Blastx: DNA (cytosine-5)-methyltransferase CMT3 from Oryza sativa with 70.83% of identity
• Eggnog: Cytosine-specific methyltransferase(COG0270)
• Kegg: Link to kegg annotations (4332128)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448358.1)
• Pfam: C-5 cytosine-specific DNA methylase (PF00145.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;