Protein coding transcript 141891

• Transcript: Ll_transcript_271850
• CDS coordinates: 2-673 (+)
• Peptide sequence: FPQKPIPPFKNLIFYFSFPLRNPNPNTPCLKATPMAFQTPNHDSGSESNNNQKRLYNPYKDLEVPIRNLYQLPTSPEHLFVEEARRKHRSWGENVTFYTGCGYLAGAVGGAGVGLVEAVKAFESGDTNKLRINRVLNTSGHSGRVWGNRLGVIGLLYAGIESGIAEARDTDDVWNSVAAGLGTGALYRAARGVRSAAVAGAVGGVVVGVVVTAKQALKRYVPI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_271850

• Blastp: Mitochondrial import inner membrane translocase subunit TIM23-2 from Arabidopsis with 67.39% of identity
• Blastx: Mitochondrial import inner membrane translocase subunit TIM23-2 from Arabidopsis with 67.03% of identity
• Eggnog: mitochondrial import inner membrane translocase, subunit(COG5596)
• Kegg: Link to kegg annotations (AT1G72750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436510.1)
• Pfam: Tim17/Tim22/Tim23/Pmp24 family (PF02466.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;