Protein coding transcript 141934

• Transcript: Ll_transcript_271367
• CDS coordinates: 458-1144 (+)
• Peptide sequence: MDLKRKISFKKLKEKTLSPEEQQAKIEEVKKTIGPIADKFPTLCSDASVLRYLKARKYNTKKAAKMLKSTIKWRFEFKPEKIRWDDIAQEASTGTLYKADYLDKQGRIVLVMRPGIQGTNSATGQIKYLVYCLENAILNLSSNQEQMVWLIDFQGWSTSSISLKVTKETAQVLQDHYPERLAFAIFYNPPKVFESFLMVCYPNMSYLSSFMNTYQLYQKCVPNSLSFR*
• ORF Type: complete

Annotations of Ll_transcript_271367

• Blastp: Random slug protein 5 from Dictyostelium with 31.32% of identity
• Blastx: Random slug protein 5 from Dictyostelium with 31.32% of identity
• Eggnog: CRAL TRIO domain protein(ENOG410Y3Q0)
• Kegg: Link to kegg annotations (DDB_G0269182)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432453.1)
• Pfam: CRAL/TRIO, N-terminal domain (PF03765.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;