| Transcript | Ll_transcript_271763 |
|---|---|
| CDS coordinates | 1-714 (+) |
| Peptide sequence | IPLRIDDVSGSSNFHDVKVPTGTVIQSCNGLVLIQRNSLQRFSEVEYFICNPTTNKSAPVIFPNQQFSSSVVSLFICFEPLKSLHYRLVSVRFKNYKSFSDMGNVVVPTNIPRPAYVINVFSSETSSWSEPGFTFTSPNYAPPNQTNTVYFNGSLYWHSDSLWKFFYFNLDSQILKTCPTPLNIEDKGLSKFCESGGHLYFVHEPLSDSELNIMELNEEKSEWSLIFILEFCESARE* |
| ORF Type | 5prime_partial |
| Blastp | F-box protein At5g07610 from Arabidopsis with 27.1% of identity |
|---|---|
| Blastx | F-box protein At5g07610 from Arabidopsis with 27.1% of identity |
| Eggnog | F-box protein(ENOG410YS8Z) |
| Kegg | Link to kegg annotations (AT5G07610) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019427232.1) |
| Pfam | - |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer