Protein coding transcript 142052

• Transcript: Ll_transcript_271574
• CDS coordinates: 1-408 (+)
• Peptide sequence: AKFRKVREELNEWETLQSRLISQFRNASHIIDRLQMLQSSKSYGDLNCINGVREAVLAKQVQSLNNIFVSMKRTLEDFHSIVLSLEKTHRDGRQLVKGGSSQPKVKQLQQRVGVKPTLTDCLDGLLFLHEIHQSE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_271574

• Blastp: Uncharacterized protein At5g43822 from Arabidopsis with 50% of identity
• Blastx: Uncharacterized protein At5g43822 from Arabidopsis with 50% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT5G43822)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446258.1)
• Pfam: Casein Kinase 2 substrate (PF15011.5)
• Rfam: -
• GO: -