| Transcript | Ll_transcript_271575 |
|---|---|
| CDS coordinates | 1-570 (+) |
| Peptide sequence | AKFRKVREELNEWETLQSRLISQFRNASHIIDRLQMLQSSKSYGDLNCINGVREAVLAKQVQSLNNIFVSMKRTLEDFHSIVLSLEKTHRDGRQLVKGGSSQPKVKQLQQRVGVKPTLTDCLDGLLFLHEIHQSEYLLKSSVISELSGLALKPSSSDLGALQQLLVDQPNLPSEEVQFVFDIIFAEELC* |
| ORF Type | 5prime_partial |
| Blastp | Uncharacterized protein At5g43822 from Arabidopsis with 54.55% of identity |
|---|---|
| Blastx | Uncharacterized protein At5g43822 from Arabidopsis with 54.55% of identity |
| Eggnog | Pentatricopeptide repeat-containing protein(ENOG410Z7Z7) |
| Kegg | Link to kegg annotations (AT5G43822) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019412983.1) |
| Pfam | Casein Kinase 2 substrate (PF15011.5) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer