Transcript | Ll_transcript_271577 |
---|---|
CDS coordinates | 1-567 (+) |
Peptide sequence | AKFRKVREELNEWETLQSRLISQFRNASHIIDRLQMLQSSKSYGDLNCINGVREAVLAKQVQSLNNIFVSMKRTLEDFHSIVLSLEKTHRDGRQLVKGGSSQPKVKQLQQRVGVKPTLTDCLDGLLFLHEIHQSEYLLKSSVISELSGLALKPSSSDLGALQQLLVDQPNLPSEEGMEELSVDQKSFN* |
ORF Type | 5prime_partial |
Blastp | Uncharacterized protein At5g43822 from Arabidopsis with 53.45% of identity |
---|---|
Blastx | Uncharacterized protein At5g43822 from Arabidopsis with 53.45% of identity |
Eggnog | Pentatricopeptide repeat-containing protein(ENOG410Z7Z7) |
Kegg | Link to kegg annotations (AT5G43822) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019465200.1) |
Pfam | Casein Kinase 2 substrate (PF15011.5) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer