Transcript | Ll_transcript_271412 |
---|---|
CDS coordinates | 1850-2704 (+) |
Peptide sequence | MDDTLKFGTEDIGEEQEIQYSVAELTEEGQQIIIARGGEGGLGNVSMSKDLRKSMATKVGAYQDRPDLDDSDSDYSSLSGGVPGSETVLILELKSIADVSFVGMPNAGKSTLLGAISRAKPAVGHYAFTTLRPNLGNLNYDDFSITVADIPGLIKGAHENRGLGHAFLRHIERTKVLAYVVDLAAALDGRKGIPPWEQLKDLILELEYHQDGLSNRPSLIVANKIDEEGAEEVYKELQRRVQGATIFPVCAVLGDGIPELKAGLRLLVNSEMSSTLSLDQIFID* |
ORF Type | complete |
Blastp | Probable GTP-binding protein OBGM, mitochondrial from Arabidopsis with 68.25% of identity |
---|---|
Blastx | Probable GTP-binding protein OBGM, mitochondrial from Arabidopsis with 50.09% of identity |
Eggnog | An essential GTPase which binds GTP, GDP and possibly (p)ppGpp with moderate affinity, with high nucleotide exchange rates and a fairly low GTP hydrolysis rate (By similarity). It may play a role in control of the cell cycle, stress response, ribosome biogenesis and in those bacteria that undergo differentiation, in morphogenesis control(COG0536) |
Kegg | Link to kegg annotations (AT1G07615) |
CantataDB | Link to cantataDB annotations (CNT0002738) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453178.1) |
Pfam | 50S ribosome-binding GTPase (PF01926.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer