Protein coding transcript 142226

• Transcript: Ll_transcript_271857
• CDS coordinates: 368-1342 (+)
• Peptide sequence: MKSMVSPVTRVSLFCGLNIHKASFSPLTFFNSYSLPFTPTLSLSMAASSQSTPSTVSPGDVNINKDDVFQLIQAHQEKAARLPPVEEIRTVLDRSVRGMLSTFSKAHEGYPSGSLVDFAFDADGYPILAVSDLAVHAKDLTANPKCSLLVARDPEDRTDLVITLHGDAISVSEKDKEAVRAAYLARHPNAFWVDFGDFHFLRIEPKVVRFVSGVATALLGSGEFTGDEFKAAKVDPIAQFSKPVASHMNNDHAEDTKVIVQHWTSVPVDFANILDLDSLGFNVKAGYQGSTFKLRVPFPRRAADRKDVKTLIVEMLHAATPKVN*
• ORF Type: complete

Annotations of Ll_transcript_271857

• Blastp: Glutamyl-tRNA reductase-binding protein, chloroplastic from Arabidopsis with 23.75% of identity
• Blastx: Glutamyl-tRNA reductase-binding protein, chloroplastic from Arabidopsis with 23.75% of identity
• Eggnog: NA(ENOG410XX7U)
• Kegg: Link to kegg annotations (AT3G21200)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457130.1)
• Pfam: Pyridoxamine 5'-phosphate oxidase (PF01243.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;