Transcript | Ll_transcript_206174 |
---|---|
CDS coordinates | 576-1064 (+) |
Peptide sequence | MIMKAVEALNEPNGSNKSAIASYIESTYGEIPAGHTVLLTHHLHKMKESGELVFLKNNYMKPDPNAPPKRGRGRPPKPKAPVPSGTTVSSPRPRGRPPKDPNAPPSAKVVPSGSGRPRGRPKKIARTVSPPPPVSAALANSGRPRGRPPKVKPQLTEVSVES* |
ORF Type | complete |
Blastp | HMG-Y-related protein A from Soja with 72.29% of identity |
---|---|
Blastx | HMG-Y-related protein A from Soja with 70.48% of identity |
Eggnog | HMG-Y-related protein(ENOG410YQM8) |
Kegg | Link to kegg annotations (548080) |
CantataDB | Link to cantataDB annotations (CNT0002659) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462062.1) |
Pfam | linker histone H1 and H5 family (PF00538.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer