| Transcript | Ll_transcript_503192 |
|---|---|
| CDS coordinates | 3-320 (+) |
| Peptide sequence | DLQRGNKDQTTNPSWKHTARFDVVGEQNELDISVYDNVNDEAFLGHVRIPINLEDYEHQHEGWYKLQGDDQHSGLITGDVHVRIAFHGTGKKSFGPEDFEVLKLIG |
| ORF Type | internal |
| Blastp | Serine/threonine-protein kinase SCH9 from Saccharomyces with 39.42% of identity |
|---|---|
| Blastx | Serine/threonine-protein kinase SCH9 from Saccharomyces with 39.42% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (YHR205W) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_003522401.1) |
| Pfam | C2 domain (PF00168.29) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer