Protein coding transcript 1424

• Transcript: Ll_transcript_503205
• CDS coordinates: 37-510 (+)
• Peptide sequence: MLIYKDVLSGDEMISDSYDIKLVDGAVYEVDCANIVVGNDNIDIGANPSAEDGGDEGADDTAETAIDVVHSFRLVKTSFDKKSYMGYLKQYIKKVKEHMKSRNASEDEIKEFEAGVKAYVSRQTFKKFEYDFYTGESMDPDGMLVLLDFRDDGITPYC
• ORF Type: 3prime_partial

Annotations of Ll_transcript_503205

• Blastp: Translationally-controlled tumor protein homolog from Kluyveromyces with 55.7% of identity
• Blastx: Translationally-controlled tumor protein homolog from Kluyveromyces with 55.7% of identity
• Eggnog: tumor protein(ENOG4111FVP)
• Kegg: Link to kegg annotations (KLLA0C12716g)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004487845.1)
• Pfam: Translationally controlled tumour protein (PF00838.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;