Protein coding transcript 1425

• Transcript: Ll_transcript_503172
• CDS coordinates: 2-361 (+)
• Peptide sequence: EVTQIIAKIGAAYGVKKLLIGQNGIMSTPAASHLIRIRNATGGILLTASHNPGGPNEDFGIKYNLANGAPAPESVTNKMFENSKAITSYKIADIPDVDLSTIGTKTYGPLEVEIVDSTKD
• ORF Type: internal

Annotations of Ll_transcript_503172

• Blastp: Phosphoglucomutase from Aspergillus with 85% of identity
• Blastx: Phosphoglucomutase from Aspergillus with 85% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AFUA_3G11830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422001.1)
• Pfam: Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I (PF02878.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;