Protein coding transcript 142519

• Transcript: Ll_transcript_206040
• CDS coordinates: 1-477 (+)
• Peptide sequence: DQGCEGGLMDDAFKFIIKNHGLNTEANYPYKGVDGTCNANEATNDAATITGYEDVPANNEQALQKAVANQPISVAIDASGSDFQFYQGGVFTGSCGTQLDHGVTAVGYGVSADGLKYWLVKNSWGAQWGEEGYIRMQRDVAANGGLCGIAMQASYPTA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_206040

• Blastp: Senescence-specific cysteine protease SAG39 from Oryza sativa with 65.82% of identity
• Blastx: Senescence-specific cysteine protease SAG39 from Oryza sativa with 65.82% of identity
• Eggnog: cathepsin(COG4870)
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002198)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431762.1)
• Pfam: Papain family cysteine protease (PF00112.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;