Protein coding transcript 142530

• Transcript: Ll_transcript_206431
• CDS coordinates: 213-647 (+)
• Peptide sequence: MKQVTALQLFRDVANKPRSRLLGLDVGDKYVGLALSDFNNQIASPFSVLVRKKSNIALMASDFECLISQYSLKGFVIGIPFDRHRVSADAVQVKAFINDLSSTKKLQERGVVFKASGLVSSLSFQDYARQVCCCRNTSGVPGLC*
• ORF Type: complete

Annotations of Ll_transcript_206431

• Blastp: Putative pre-16S rRNA nuclease from Beijerinckia with 37.08% of identity
• Blastx: Probable copper-transporting ATPase HMA5 from Arabidopsis with 80% of identity
• Eggnog: Could be a nuclease that resolves Holliday junction intermediates in genetic recombination (By similarity)(COG0816)
• Kegg: Link to kegg annotations (Bind_1895)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420916.1)
• Pfam: Holliday junction resolvase (PF03652.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;