Transcript | Ll_transcript_206035 |
---|---|
CDS coordinates | 2-532 (+) |
Peptide sequence | VDTLWALAYGGPLSLLPLAISSVHEETLEPQQGNFSVAAATTCLAASIFRIISVAIQHPRNNEDLSHGKGPEILSKILNYLLQTLSSLDIGKHDGVRDEELVAAIVSLCQSQKINHMLKVQLFTTLLLDLKIWSLCSYGIQKKLLSSLADMVFTDSIVMRDANAIQMLIDGCRRCYW |
ORF Type | internal |
Blastp | BEACH domain-containing protein C2 from Arabidopsis with 71.75% of identity |
---|---|
Blastx | BEACH domain-containing protein C2 from Arabidopsis with 71.75% of identity |
Eggnog | beige BEACH domain containing protein(ENOG410XNQC) |
Kegg | Link to kegg annotations (AT2G45540) |
CantataDB | Link to cantataDB annotations (CNT0001256) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431479.1) |
Pfam | Domain of unknown function (DUF4704) (PF15787.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer