Protein coding transcript 142546

• Transcript: Ll_transcript_206445
• CDS coordinates: 22-1182 (+)
• Peptide sequence: MGESLSGATLIHNPTPKVENDMMSIFDKHLLQNISELPQQFQWPSEQLVETSHESLNEPLIDLGVLKTGDEVAIAKAAELVRNACMKHGVFQVINHGVDLDLIKSAYEEMDTIFNLPMSQKLSVKKKEGSQEGYSGGHGDRFSSRLPWKEILTFINDYSKVSSDSQVLDYFVSNFGPQFQHTGLVFQKYCEALKEISHSVMELLAISLGVDRMHYKEFFDDGYLVMRVNSYPPCLDSAHTFGTGPHTDPTSLTFLHQDQVGGLEVFSDNKWLQVRPRPDAFVINIGDTFTALTNGIYKSCLHRVLVNKEVQRKSMSGFLDPRGDKVLRAPESLFSKDAPRKYPDFTWANFLEFTQKHHRAEANTLDVYFSWLASSKSAPADSATEV*
• ORF Type: complete

Annotations of Ll_transcript_206445

• Blastp: Gibberellin 20 oxidase 2 from Arabidopsis with 46.32% of identity
• Blastx: Gibberellin 20 oxidase 2 from Arabidopsis with 46.21% of identity
• Eggnog: 2OGFe(II) oxygenase(COG3491)
• Kegg: Link to kegg annotations (AT5G51810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458758.1)
• Pfam: non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;