Protein coding transcript 142715

• Transcript: Ll_transcript_261708
• CDS coordinates: 324-1313 (+)
• Peptide sequence: MEFGGSSSSFCLQHRVTPFTRTIGINNSGEWKRSSTKTGYSNIVRCCNSVSYKKFVNFALDQTTHHTLLLPSPLQEKYNSLNSKDGKGELSMLSFQAAKIRLLRSLIIESETMQVLDFTVFPKAEYDTPIFCANFFTTARTNIVVLDLNPLHDIINQGDYKKKYFKSLIPLGLKYAEHFPWGGKLTSESIKFFSPIVIWTKFTSSAQNYDILYSAFKDYYKVWLELVGSAVKETDESQILRNLQAQHRYLTWRAEKDPGQGVLKKLIGDTLAKDLLRNFLFNGVDELGSKKFSDYFPQYGCEEENKKPSTIGKSFETRPWDANGEFLGE*
• ORF Type: complete

Annotations of Ll_transcript_261708

• Blastp: Phytochromobilin:ferredoxin oxidoreductase, chloroplastic from Arabidopsis with 58.1% of identity
• Blastx: Phytochromobilin:ferredoxin oxidoreductase, chloroplastic from Arabidopsis with 58.1% of identity
• Eggnog: Catalyzes the two-electron reduction of the C2 and C3(1) diene system of 15,16-dihydrobiliverdin (By similarity)(ENOG41102EM)
• Kegg: Link to kegg annotations (AT3G09150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435724.1)
• Pfam: Ferredoxin-dependent bilin reductase (PF05996.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;