Protein coding transcript 142717

• Transcript: Ll_transcript_262052
• CDS coordinates: 83-619 (+)
• Peptide sequence: MASSFSIATPTTLTNVPELIIRNRACFNRNPNVSMRGFHNQPRLNLNLNTNGRSPTLRNKGFSSLVVRASTEEAVVPQSKVTHKVYFDISIGNPVGKLAGRIVIGLFGDDVPQTVENFRALATGEKGFGYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKCEFTHSC*
• ORF Type: complete

Annotations of Ll_transcript_262052

• Blastp: Photosynthetic NDH subunit of lumenal location 5, chloroplastic from Arabidopsis with 84.76% of identity
• Blastx: Photosynthetic NDH subunit of lumenal location 5, chloroplastic from Arabidopsis with 84.76% of identity
• Eggnog: PPIases accelerate the folding of proteins (By similarity)(ENOG410Z0G4)
• Kegg: Link to kegg annotations (AT5G13120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428470.1)
• Pfam: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD (PF00160.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;